PKC iota (PRKCI) Rabbit Polyclonal Antibody
Other products for "PRKCI"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PRKCI antibody: synthetic peptide directed towards the middle region of human PRKCI. Synthetic peptide located within the following region: TVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGS |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Concentration | lot specific |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 68 kDa |
| Gene Name | protein kinase C iota |
| Database Link | |
| Background | This gene encodes a member ofThe protein kinase C (PKC) family of serine/threonine protein kinases.The PKC family comprises at least eight members, which are differentially expressed and are involved in a wide variety of cellular processes.This protein kinase is calcium-independent and phospholipid-dependent. It is not activated by phorbolesters or diacylglycerol.This kinase can be recruited to vesicle tubular clusters (VTCs) by direct interaction withThe small GTPase RAB2, whereThis kinase phosphorylates glyceraldehyde-3-phosphate dehydrogenase (GAPD/GAPDH) and plays a role in microtubule dynamics inThe early secretory pathway.This kinase is found to be necessary for BCL-ABL-mediated resistance to drug-induced apoptosis andTherefore protects leukemia cells against drug-induced apoptosis.There is a single exon pseudogene mapped on chromosome X. [provided by RefSeq, Jul 2008] |
| Synonyms | DXS1179E; nPKC-iota; PKCI |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
| Reference Data | |
| Protein Families | Druggable Genome, Protein Kinase |
| Protein Pathways | Endocytosis, Insulin signaling pathway, Tight junction |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China