Cyclophilin 40 (PPID) Rabbit Polyclonal Antibody

CAT#: TA342237

Rabbit polyclonal Anti-PPID Antibody

Product Images

WB Suggested Anti-PPID Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPID antibody: synthetic peptide directed towards the N terminal of human PPID. Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: peptidylprolyl isomerase D
• Database Link:
  NP_005029
  Entrez Gene 5481 Human
  UniProt ID Q08752
• Background: The protein encoded byThis gene is a member ofThe peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyzeThe cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerateThe folding of proteins.This protein has been shown to possess PPIase activity and, similar to other family members, can bind toThe immunosuppressant cyclosporin A. [provided by RefSeq, Jul 2008]
• Synonyms: CYP-40; CYPD
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 86%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Calcium signaling pathway, Huntington's disease, Parkinson's disease