TBX5 Rabbit Polyclonal Antibody

CAT#: TA342293

Rabbit Polyclonal Anti-Tbx5 Antibody

Product Images

Host: Rabbit; Target Name: Tbx5; Sample Tissue: Mouse Pancreas lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tbx5 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tbx5. Synthetic peptide located within the following region: TDEGFGLARTPLEPDSKDRSCDSKPESALGAPSKSPSSPQAAFTQQGMEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: T-box 5
• Database Link:
  NP_000183
  Entrez Gene 21388 Mouse
  UniProt ID Q99593
• Background: Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
• Synonyms: HOS
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Guinea pig: 93%; Rabbit: 92%; Horse: 86%; Human: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors