TBX21 Rabbit Polyclonal Antibody

CAT#: TA342329

Rabbit Polyclonal Anti-Tbx21 Antibody

Product Images

WB Suggested Anti-Tbx21 Antibody Titration: 0.2-1 ug/ml; Positive Control: NIH/3T3 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tbx21 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPTDRRAG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 58 kDa
• Gene Name: T-box 21
• Database Link:
  NP_037483
  Entrez Gene 57765 Mouse
  UniProt ID Q9UL17
• Background: Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs.
• Synonyms: T-bet; T-PET; TBET; TBLYM
• Note: Immunogen Sequence Homology: Mouse: 100%; Rat: 93%; Human: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors