TBX21 Rabbit Polyclonal Antibody

CAT#: TA342330

Rabbit Polyclonal Anti-TBX21 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "TBX21"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TBX21 antibody: synthetic peptide directed towards the C terminal of mouse TBX21. Synthetic peptide located within the following region: MDPGLGSSEEQGSSPSLWPEVTSLQPESSDSGLGEGDTKRRRISPYPSSG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 58 kDa
Gene Name T-box 21
Background Transcription factor that controls the expression of the TH1 cytokine, interferon-gamma. Initiates TH1 lineage development from naive TH precursor cells both by activating TH1 genetic programs and by repressing the opposing TH2 programs.
Synonyms T-bet; T-PET; TBET; TBLYM
Note Immunogen Sequence Homology: Pig: 93%; Rat: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Sheep: 86%; Bovine: 86%
Reference Data
Protein Families Druggable Genome, Transcription Factors

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.