Transmembrane protein 30A (TMEM30A) Rabbit Polyclonal Antibody

CAT#: TA342365

Rabbit Polyclonal Anti-TMEM30A Antibody

Product Images

WB Suggested Anti-TMEM30A Antibody Titration: 1 ug/ml; Positive Control: HepG2 cell lysate

• 

  Host: Rabbit; Target Name: TMEM30A; Sample Tissue: 721_B; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Concentration:

• 

  Rabbit Anti-TMEM30A Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TMEM30A antibody is: synthetic peptide directed towards the middle region of Human TMEM30A. Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: transmembrane protein 30A
• Database Link:
  NP_060717
  Entrez Gene 55754 Human
  UniProt ID Q9NV96
• Background: The function of this protein remains unknown.
• Synonyms: C6orf67; CDC50A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 92%

Reference Data

• Protein Families: Druggable Genome, Transmembrane