C6orf64 (SAYSD1) Rabbit Polyclonal Antibody

CAT#: TA342367

Rabbit Polyclonal Anti-C6orf64 Antibody

Product Images

WB Suggested Anti-C6orf64 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: 293T cell lysate.SAYSD1 is supported by BioGPS gene expression data to be expressed in HEK293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C6orf64 antibody: synthetic peptide directed towards the C terminal of human C6orf64. Synthetic peptide located within the following region: MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 20 kDa
• Gene Name: SAYSVFN motif domain containing 1
• Database Link:
  NP_060792
  Entrez Gene 55776 Human
  UniProt ID Q9NPB0
• Background: The exact function of C6orf64 remains unknown.
• Synonyms: C6orf64
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Zebrafish: 92%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane