METT10D (METTL16) Rabbit Polyclonal Antibody

CAT#: TA342474

Rabbit Polyclonal Anti-METTL16 Antibody

Product Images

Host: Rabbit; Target Name: METTL16; Sample Tissue: Esophagus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-METTL16 antibody is: synthetic peptide directed towards the middle region of Human METTL16. Synthetic peptide located within the following region: QGRTMRWALAWSFYDDVTVPSPPSKRRKLEKPRKPITFVVLASVMKELSL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 63 kDa
• Gene Name: methyltransferase like 16
• Database Link:
  NP_076991
  Entrez Gene 79066 Human
  UniProt ID Q86W50
• Background: Probable methyltransferase.
• Synonyms: METT10D
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%