IRX2 Rabbit Polyclonal Antibody

CAT#: TA342486

Rabbit Polyclonal Anti-IRX2 Antibody

Product Images

WB Suggested Anti-IRX2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IRX2 antibody: synthetic peptide directed towards the N terminal of human IRX2. Synthetic peptide located within the following region: AYPYQLNDPAYRKNATRDATATLKAWLNEHRKNPYPTKGEKIMLAIITKM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: iroquois homeobox 2
• Database Link:
  NP_150366
  Entrez Gene 153572 Human
  UniProt ID Q9BZI1
• Background: IRX2 is a member of the Iroquois homeobox gene family. Members of this family appear to play multiple roles during pattern formation of vertebrate embryos. [supplied by OMIM, Apr 2004]. Transcript Variant: This variant (1) represents the longer transcript. ##Evidence-Data-START## Transcript exon combination :: AB188492.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## COMPLETENESS: complete on the 3' end.
• Synonyms: IRXA2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors