ZNF367 Rabbit Polyclonal Antibody

CAT#: TA342507

Rabbit Polyclonal Anti-Zfp367 Antibody

Product Images

Host: Rabbit; Target Name: Zfp367; Sample Tissue: Rat Spleen lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Zfp367 antibody is: synthetic peptide directed towards the C-terminal region of Rat Zfp367. Synthetic peptide located within the following region: AAEWLAKYWEMREQRTPTLKGKLVQKADQEQQDPLEYLQSDEEDDEKSGA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: zinc finger protein 367
• Database Link:
  NP_710162
  Entrez Gene 195828 Human
  UniProt ID Q7RTV3
• Background: Transcriptional activator. May be involved in transcriptional activation of erythroid genes.
• Synonyms: AFF29; CDC14B; ZFF29
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 85%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors