ZNF367 Rabbit Polyclonal Antibody

CAT#: TA342509

Rabbit Polyclonal Anti-ZNF367 Antibody

Product Images

WB Suggested Anti-ZNF367 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF367 antibody: synthetic peptide directed towards the middle region of human ZNF367. Synthetic peptide located within the following region: DTVRDLINEGEHSSSRIRCNICNRVFPREKSLQAHKRTHTGERPYLCDYP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: zinc finger protein 367
• Database Link:
  NP_710162
  Entrez Gene 195828 Human
  UniProt ID Q7RTV3
• Background: ZNF367 is a transcriptional activator. Isoform 1 may be involved in transcriptional activation of erythroid genes.
• Synonyms: AFF29; CDC14B; ZFF29
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transcription Factors