Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody

CAT#: TA342513

Rabbit Polyclonal Anti-GAS7 Antibody

Product Images

WB Suggested Anti-GAS7 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: MCF7 cell lysate

• 

  Host: Rabbit; Target Name: GAS7; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: GAS7; Sample Tissue: Human 721_B; Antibody Dilution: 1.0 ug/ml;There is BioGPS gene expression data showing that GAS7 is expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: growth arrest specific 7
• Database Link:
  NP_958839
  Entrez Gene 8522 Human
  UniProt ID O60861
• Background: Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]
• Synonyms: GAS7; MLL
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%

Reference Data

• Protein Families: Transcription Factors