Antibodies

Jump to Filters
View as table Download
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA329638

USD 310.00

5 Days

Rabbit Polyclonal anti-GAS7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: PGSHRSSLPPTVNGYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKK
Growth Arrest Specific Protein 7 (GAS7) (C-term) Rabbit Polyclonal Antibody
AP17417PU-N

USD 450.00

2 Weeks

Growth Arrest Specific Protein 7 (GAS7) (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human GAS7
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA342513

USD 375.00

5 Days

Rabbit Polyclonal Anti-GAS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the N terminal of human GAS7. Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA342514

USD 310.00

5 Days

Rabbit Polyclonal Anti-GAS7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAS7 antibody: synthetic peptide directed towards the C terminal of human GAS7. Synthetic peptide located within the following region: IRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGN
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2F6]
CF501756

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF501779

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI6G5]
CF501825

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
CF501872

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI8H10]
CF501907

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GAS7 mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA323843

USD 345.00

In Stock

Anti-GAS7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 184-382 amino acids of human growth arrest-specific 7
Growth Arrest Specific Protein 7 (GAS7) Rabbit Polyclonal Antibody
TA376487

USD 220.00

3 Weeks

GAS7 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-412 of human GAS7 (NP_001124303.1).
Modifications Unmodified
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501756

USD 379.00

In Stock

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]
TA501756AM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F6]
TA501756BM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2F6]
TA501756S

USD 159.00

In Stock

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA501779

USD 379.00

In Stock

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D11]
TA501779AM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA501779BM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA501779S

USD 159.00

2 Days

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI6G5]
TA501825

USD 379.00

In Stock

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G5]
TA501825AM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6G5]
TA501825BM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI6G5]
TA501825S

USD 159.00

2 Days

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI6G5 (formerly 6G5)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA501872

USD 379.00

In Stock

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E6]
TA501872AM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), Biotinylated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E6]
TA501872BM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6), HRP conjugated

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI4E6]
TA501872S

USD 159.00

2 Days

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI4E6 (formerly 4E6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI9H6]
TA501873

USD 379.00

In Stock

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI9H6]
TA501873AM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9H6]
TA501873BM

USD 420.00

4 Weeks

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6), HRP conjugated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI9H6]
TA501873S

USD 159.00

2 Days

Anti-GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI9H6 (formerly 9H6)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI8H10]
TA501907

USD 379.00

In Stock

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8H10]
TA501907AM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8H10]
TA501907BM

USD 420.00

4 Weeks

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Growth Arrest Specific Protein 7 (GAS7) Mouse Monoclonal Antibody [Clone ID: OTI8H10]
TA501907S

USD 159.00

2 Days

GAS7 (Growth Arrest Specific Protein 7) mouse monoclonal antibody, clone OTI8H10 (formerly 8H10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated