THG1L Rabbit Polyclonal Antibody
Other products for "THG1L"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Thg1l antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RNFHRFAEEHNFAKPNDSRALHLMTKCAQTVMEELEDIVIAYGQSDEYSF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 35 kDa |
Gene Name | tRNA-histidine guanylyltransferase 1 like |
Database Link | |
Background | Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis. |
Synonyms | hTHG1; ICF45; IHG-1 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Mouse: 93%; Guinea pig: 93%; Yeast: 92%; Bovine: 86%; Zebrafish: 82% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.