Germany
Japan
United Kingdom
China
THG1L Rabbit Polyclonal Antibody
Product Images
Other products for "THG1L"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-THG1L antibody: synthetic peptide directed towards the middle region of human THG1L. Synthetic peptide located within the following region: DCHINNLYNTVFWALIQQSGLTPVQAQGRLQGTLAADKNEILFSEFNINY |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 35 kDa |
| Gene Name | tRNA-histidine guanylyltransferase 1 like |
| Database Link | |
| Background | THG1L adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. |
| Synonyms | hTHG1; ICF45; IHG-1 |
| Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Pig: 91%; Rat: 86%; Guinea pig: 86%; Yeast: 83%; Zebrafish: 83%; Mouse: 79% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.