FBXO42 Rabbit Polyclonal Antibody

CAT#: TA342548

Rabbit Polyclonal Anti-FBXO42 Antibody

Product Images

WB Suggested Anti-FBXO42 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FBXO42 antibody: synthetic peptide directed towards the middle region of human FBXO42. Synthetic peptide located within the following region: RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 78 kDa
• Gene Name: F-box protein 42
• Database Link:
  NP_061867
  Entrez Gene 54455 Human
  UniProt ID Q6P3S6
• Background: Members of the F-box protein family, such as FBXO42, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (SKP1A; MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]). [supplied by OMIM, Dec 2010]. ##Evidence-Data-START## Transcript exon combination :: BC063864.1, BC043410.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025084, ERS025093 [ECO:0000348] ##Evidence-Data-END##
• Synonyms: Fbx42; JFK
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome