GODZ (ZDHHC3) Rabbit Polyclonal Antibody

CAT#: TA342658

Rabbit Polyclonal Anti-ZDHHC3 Antibody

Product Images

WB Suggested Anti-ZDHHC3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: ACHN cell lysate ZDHHC3 is supported by BioGPS gene expression data to be expressed in ACHN

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZDHHC3 antibody: synthetic peptide directed towards the C terminal of human ZDHHC3. Synthetic peptide located within the following region: MFGTQVHSICTDETGIEQLKKEERRWAKKTKWMNMKAVFGHPFSLGWASP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: zinc finger DHHC-type containing 3
• Database Link:
  NP_001128651
  Entrez Gene 51304 Human
  UniProt ID Q9NYG2
• Background: ZDHHC3 is a palmitoyltransferase with broad specificity. ZDHHC3 palmitoylates GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3), which regulates synaptic clustering and/or cell surface stability. ZDHHC3 palmitoylates glutamate receptors GRIA1 and GRIA2, which leads to their retention in Golgi.
• Synonyms: DHHC-3; GODZ; ZNF373
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane