IGSF8 Rabbit Polyclonal Antibody

CAT#: TA342765

Rabbit Polyclonal Anti-IGSF8 Antibody

Product Images

WB Suggested Anti-IGSF8 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: 721_B cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IGSF8 antibody: synthetic peptide directed towards the middle region of human IGSF8. Synthetic peptide located within the following region: LAVEAGAPYAERLAAGELRLGKEGTDRYRMVVGGAQAGDAGTYHCTAAEW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 65 kDa
• Gene Name: immunoglobulin superfamily member 8
• Database Link:
  NP_443100
  Entrez Gene 93185 Human
  UniProt ID Q969P0
• Background: IGSF8 may play a key role in diverse functions ascribed to CD81 and CD9 such as oocytes fertilization or hepatitis C virus function. IGSF8 may regulate proliferation and differentiation of keratinocytes. IGSF8 may be a negative regulator of cell motility: suppresses T-cell mobility coordinately with CD81, associates with CD82 to suppress prostate cancer cell migration, regulates epidermoid cell reaggregation and motility on laminin-5 with CD9 and CD81 as key linkers. IGSF8 may also play a role on integrin-dependent morphology and motility functions. IGSF8 may participate in the regulation of neurite outgrowth and maintenance of the neural network in the adult brain.
• Synonyms: CD81P3; CD316; EWI-2; EWI2; KCT-4; LIR-D1; PGRL
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 83%; Dog: 79%

Reference Data

• Protein Families: Transmembrane