GPCR MRGX2 (MRGPRX2) Rabbit Polyclonal Antibody

CAT#: TA342777

Rabbit Polyclonal Anti-MRGPRX2 Antibody

Product Images

WB Suggested Anti-MRGPRX2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRGPRX2 antibody: synthetic peptide directed towards the middle region of human MRGPRX2. Synthetic peptide located within the following region: VCVLLWALSLLLSILEGKFCGFLFSDGDSGWCQTFDFITAAWLIFLFMVL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: MAS related GPR family member X2
• Database Link:
  NP_473371
  Entrez Gene 117194 Human
  UniProt ID Q96LB1
• Background: MRGPRX2 is an orphan receptor. It probably involved in the function of nociceptive neurons. It also may regulate nociceptor function and/or development, including the sensation or modulation of pain. Cortistatin-14 seems to be a high potency ligand at this receptor. Cortistatin has several biological functions including roles in sleep regulation locomotor activity, and cortical function. In receptor-expressing cells, cortistatin-stimulated increases in intracellular Ca2+ but had no effect on basal or forskolin-stimulated cAMP levels, suggesting that this receptor is G(q)-coupled.
• Synonyms: MGRG3; MRGX2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane