Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody

CAT#: TA342840

Rabbit Polyclonal Anti-CA2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human, Rat
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 29 kDa
Gene Name carbonic anhydrase 2
Background CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye.
Synonyms CA-II; CAC; CAII; Car2; HEL-76; HEL-S-282
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 91%; Sheep: 85%; Bovine: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Nitrogen metabolism

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.