Carbonic Anhydrase II (CA2) Rabbit Polyclonal Antibody
Other products for "CA2"
Specifications
| Product Data | |
| Applications | WB |
| Recommended Dilution | WB |
| Reactivities | Human, Rat |
| Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-CA2 antibody: synthetic peptide directed towards the N terminal of human CA2. Synthetic peptide located within the following region: SQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVH |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Predicted Protein Size | 29 kDa |
| Gene Name | carbonic anhydrase 2 |
| Database Link | |
| Background | CA2 is essential for bone resorption and osteoclast differentiation. CA2 is implicated in reversible hydration of carbon dioxide. CA2 can hydrates cyanamide to urea. CA2 is involved in the regulation of fluid secretion into the anterior chamber of the eye. |
| Synonyms | CA-II; CAC; CAII; Car2; HEL-76; HEL-S-282 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 91%; Sheep: 85%; Bovine: 85% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Nitrogen metabolism |
Documents
| Product Manuals |
| FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.
Germany
Japan
United Kingdom
China