CD239 (BCAM) Rabbit Polyclonal Antibody

CAT#: TA342883

Rabbit Polyclonal Anti-BCAM Antibody

Product Images

WB Suggested Anti-BCAM Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: HepG2 cell lysate BCAM is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BCAM antibody: synthetic peptide directed towards the C terminal of human BCAM. Synthetic peptide located within the following region: SALSRDGISCEASNPHGNKRHVFHFGTVSPQTSQAGVAVMAVAVSVGLLL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 64 kDa
• Gene Name: basal cell adhesion molecule (Lutheran blood group)
• Database Link:
  NP_005572
  Entrez Gene 4059 Human
  UniProt ID P50895
• Background: Lutheran blood group glycoprotein is a member of the immunoglobulin superfamily and a receptor for the extracellular matrix protein, laminin. The protein contains five, N-terminus, extracellular immunoglobulin domains, a single transmembrane domain, and a short, C-terminal cytoplasmic tail. This protein may play a role in epithelial cell cancer and in vaso-occlusion of red blood cells in sickle cell disease. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: AU; CD239; LU; MSK19
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Horse: 93%; Dog: 86%; Rabbit: 86%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, Transmembrane