Lipoprotein a (LPA) Rabbit Polyclonal Antibody

CAT#: TA342897

Rabbit Polyclonal Anti-LPA Antibody

Product Images

WB Suggested Anti-LPA Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LPA antibody: synthetic peptide directed towards the N terminal of human LPA. Synthetic peptide located within the following region: VPDPSTEASSEEAPTEQSPGVQDCYHGDGQSYRGSFSTTVTGRTCQSWSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 120 kDa
• Gene Name: lipoprotein(a)
• Database Link:
  NP_005568
  Entrez Gene 4018 Human
• Background: LPA is a serine proteinase that inhibits the activity of tissue-type plasminogen activator I. The protein constitutes a substantial portion of lipoprotein(a) and is proteolytically cleaved, resulting in fragments that attach to atherosclerotic lesions and promote thrombogenesis. Elevated plasma levels of this protein are linked to atherosclerosis. Depending on the individual, the protein contains 2-43 copies of kringle-type domains.
• Synonyms: AK38; APOA; LP
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome