Lysozyme (LYZ) Rabbit Polyclonal Antibody

CAT#: TA342900

Rabbit Polyclonal Anti-LYZ Antibody

Product Images

WB Suggested Anti-LYZ Antibody; Titration: 1.0 ug/ml; Positive Control: ACHN Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LYZ antibody: synthetic peptide directed towards the C terminal of human LYZ. Synthetic peptide located within the following region: HLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: lysozyme
• Database Link:
  NP_000230
  Entrez Gene 4069 Human
  UniProt ID P61626
• Background: LYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
• Synonyms: LYZF1; LZM
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 79%; Pig; Horse; Guinea pig

Reference Data

• Protein Families: Druggable Genome