Lysozyme (LYZ) Rabbit Polyclonal Antibody
Other products for "LYZ"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LYZ antibody: synthetic peptide directed towards the N terminal of human LYZ. Synthetic peptide located within the following region: CLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 15 kDa |
Gene Name | lysozyme |
Database Link | |
Background | LYZ is a human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis. |
Synonyms | LYZF1; LZM |
Note | Immunogen Sequence Homology: Human: 100%; Rat: 93%; Goat: 93%; Mouse: 93%; Sheep: 93%; Bovine: 93%; Pig: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.