SH2D1A Rabbit Polyclonal Antibody

CAT#: TA342926

Rabbit Polyclonal Anti-SH2D1A Antibody

Product Images

WB Suggested Anti-SH2D1A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysate SH2D1A is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 14 kDa
• Gene Name: SH2 domain containing 1A
• Database Link:
  NP_002342
  Entrez Gene 4068 Human
  UniProt ID O60880
• Background: SH2D1A is a protein that plays a major role in the bidirectional stimulation of T and B cells. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in SH2D1A gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma.
• Synonyms: DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SH2D1A; XLP; XLPD; XLPD1
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Horse: 92%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Natural killer cell mediated cytotoxicity