SH2D1A Rabbit Polyclonal Antibody
Other products for "SH2D1A"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SH2D1A antibody: synthetic peptide directed towards the C terminal of human SH2D1A. Synthetic peptide located within the following region: YFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 14 kDa |
Gene Name | SH2 domain containing 1A |
Database Link | |
Background | SH2D1A is a protein that plays a major role in the bidirectional stimulation of T and B cells. It associates with the signaling lymphocyte-activation molecule, thereby acting as an inhibitor of this transmembrane protein by blocking the recruitment of the SH2-domain-containing signal-transduction molecule SHP-2 to its docking site. This protein can also bind to other related surface molecules that are expressed on activated T, B and NK cells, thereby modifying signal transduction pathways in these cells. Mutations in SH2D1A gene cause lymphoproliferative syndrome X-linked type 1 or Duncan disease, a rare immunodeficiency characterized by extreme susceptibility to infection with Epstein-Barr virus, with symptoms including severe mononucleosis and malignant lymphoma. |
Synonyms | DSHP; EBVS; IMD5; LYP; MTCP1; SAP; SH2D1A; XLP; XLPD; XLPD1 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Rat: 93%; Horse: 92%; Bovine: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.