GPR103 (QRFPR) Rabbit Polyclonal Antibody

CAT#: TA342967

Rabbit Polyclonal Anti-QRFPR Antibody

Product Images

WB Suggested Anti-QRFPR Antibody; Titration: 1.0 ug/ml; Positive Control: Jurkat Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-QRFPR antibody: synthetic peptide directed towards the C terminal of human QRFPR. Synthetic peptide located within the following region: FSLRENPVEETKGEAFSDGNIEVKLCEQTEEKKKLKRHLALFRSELAENS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: pyroglutamylated RFamide peptide receptor
• Database Link:
  NP_937822
  Entrez Gene 84109 Human
  UniProt ID Q96P65
• Background: G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.
• Synonyms: AQ27; GPR103; SP9155
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 86%; Pig: 85%; Bovine: 85%; Guinea pig: 85%; Horse: 79%; Rabbit; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane