RTN4IP1 Rabbit Polyclonal Antibody

CAT#: TA343013

Rabbit Polyclonal Anti-RTN4IP1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "RTN4IP1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RTN4IP1 antibody: synthetic peptide directed towards the middle region of human RTN4IP1. Synthetic peptide located within the following region: AWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 39 kDa
Gene Name reticulon 4 interacting protein 1
Background This gene encodes a novel mitochondrial protein that interacts with reticulon 4, which is a potent inhibitor of regeneration following spinal cord injury. The interaction of reticulon 4 with mitochondrial proteins may provide insight into the mechanisms for reticulon-induced inhibition of neurite growth.
Synonyms NIMP; OPA10
Note Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 86%; Mouse: 79%
Reference Data
Protein Families Druggable Genome

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.