Antibodies

View as table Download

RTN4IP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RTN4IP1

RTN4IP1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 338-367 amino acids from the C-terminal region of Human RT4I1

Rabbit Polyclonal Anti-RTN4IP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RTN4IP1 antibody: synthetic peptide directed towards the middle region of human RTN4IP1. Synthetic peptide located within the following region: AWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCS

Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RTN4IP1

RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2), Biotinylated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2), HRP conjugated

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated