RTN4IP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RTN4IP1 |
RTN4IP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RTN4IP1 |
RTN4IP1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 338-367 amino acids from the C-terminal region of Human RT4I1 |
Rabbit Polyclonal Anti-RTN4IP1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RTN4IP1 antibody: synthetic peptide directed towards the middle region of human RTN4IP1. Synthetic peptide located within the following region: AWSAINKVGGLNDKNCTGKRVLILGASGGVGTFAIQVMKAWDAHVTAVCS |
Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RTN4IP1 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RTN4IP1 |
RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RTN4IP1 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RTN4IP1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RTN4IP1 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RTN4IP1 mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RTN4IP1 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |