IRTA2 (FCRL5) Rabbit Polyclonal Antibody

CAT#: TA343079

Rabbit Polyclonal Anti-FCRL5 Antibody

Product Images

WB Suggested Anti-FCRL5 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FCRL5 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL5. Synthetic peptide located within the following region: ALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 106 kDa
• Gene Name: Fc receptor like 5
• Database Link:
  NP_112571
  Entrez Gene 83416 Human
  UniProt ID Q96RD9
• Background: This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I membrane protein and contains 8 immunoglobulin-like C2-type domains. This gene is implicated in B cell development and lymphomagenesis. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: BXMAS1; CD307; CD307e; FCRH5; IRTA2; PRO820
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane