IRTA2 (FCRL5) Rabbit Polyclonal Antibody

CAT#: TA343079

Rabbit Polyclonal Anti-FCRL5 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FCRL5"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-FCRL5 antibody is: synthetic peptide directed towards the C-terminal region of Human FCRL5. Synthetic peptide located within the following region: ALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 106 kDa
Gene Name Fc receptor like 5
Background This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I membrane protein and contains 8 immunoglobulin-like C2-type domains. This gene is implicated in B cell development and lymphomagenesis. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms BXMAS1; CD307; CD307e; FCRH5; IRTA2; PRO820
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Transmembrane

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.