Calpain 1 (CAPN1) Rabbit Polyclonal Antibody

CAT#: TA343085

Rabbit Polyclonal Anti-CAPN1 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "CAPN1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 82 kDa
Gene Name calpain 1
Background The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
Synonyms CANP; CANP1; CANPL1; muCANP; muCL
Note Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 83%; Mouse: 80%; Goat: 79%; Sheep: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish
Reference Data
Protein Families Druggable Genome, Protease
Protein Pathways Alzheimer's disease, Apoptosis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.