Calpain 1 (CAPN1) Rabbit Polyclonal Antibody

CAT#: TA343085

Rabbit Polyclonal Anti-CAPN1 Antibody

Product Images

CAPN1 antibody validated by WB using HT1080 cell lysate at 1ug/mL.

• 

  Lanes: 1. 20 ug Jurkat cell lysate; 2. 20 ug Hut-78 cell lysate; 3. 20 ug K562 cell lysate; 4. 20 ug Raj cell lysate; 5. 20 ug U937 cell lysate; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit HRP; Secondary Antibody Dilution: 1:2000; G

• 

  Primary dilution: 1ug/mL Secondary dilution: 1:2000 Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: calpain 1
• Database Link:
  NP_005177
  Entrez Gene 823 Human
  UniProt ID P07384
• Background: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
• Synonyms: CANP; CANP1; CANPL1; muCANP; muCL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 83%; Mouse: 80%; Goat: 79%; Sheep: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Alzheimer's disease, Apoptosis