CDA Rabbit Polyclonal Antibody

CAT#: TA343116

Rabbit Polyclonal Anti-CDA Antibody

Product Images

WB Suggested Anti-CDA Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDA antibody: synthetic peptide directed towards the C terminal of human CDA. Synthetic peptide located within the following region: SPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQELLPSSFGPEDLQKTQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 16 kDa
• Gene Name: cytidine deaminase
• Database Link:
  NP_001776
  Entrez Gene 978 Human
  UniProt ID P32320
• Background: This gene encodes an enzyme involved in pyrimidine salvaging. The encoded protein forms a homotetramer that catalyzes the irreversible hydrolytic deamination of cytidine and deoxycytidine to uridine and deoxyuridine, respectively. It is one of several deaminases responsible for maintaining the cellular pyrimidine pool. Mutations in this gene are associated with decreased sensitivity to the cytosine nucleoside analogue cytosine arabinoside used in the treatment of certain childhood leukemias.
• Synonyms: CDD
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 92%; Rat: 92%; Guinea pig: 92%; Zebrafish: 90%; Mouse: 86%; Bovine: 86%; Horse: 83%; Yeast: 83%

Reference Data

• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Drug metabolism - other enzymes, Metabolic pathways, Pyrimidine metabolism