NQO1 Rabbit Polyclonal Antibody

CAT#: TA343122

Rabbit Polyclonal Anti-NQO1 Antibody

Product Images

WB Suggested Anti-NQO1 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell There is BioGPS gene expression data showing that NQO1 is expressed in 721_B

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NQO1 antibody: synthetic peptide directed towards the C terminal of human NQO1. Synthetic peptide located within the following region: WKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: NAD(P)H quinone dehydrogenase 1
• Database Link:
  NP_000894
  Entrez Gene 1728 Human
  UniProt ID P15559
• Background: This gene is a member of the NAD(P)H dehydrogenase (quinone) family and encodes a cytoplasmic 2-electron reductase. This FAD-binding protein forms homodimers and reduces quinones to hydroquinones. This protein's enzymatic activity prevents the one electron reduction of quinones that results in the production of radical species. Mutations in this gene have been associated with tardive dyskinesia (TD), an increased risk of hematotoxicity after exposure to benzene, and susceptibility to various forms of cancer. Altered expression of this protein has been seen in many tumors and is also associated with Alzheimer's disease (AD). Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Synonyms: DHQU; DIA4; DTD; NMOR1; NMORI; QR1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 93%; Rabbit: 91%; Bovine: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome