DHPS Rabbit Polyclonal Antibody

CAT#: TA343131

Rabbit Polyclonal Anti-DHPS Antibody

Product Images

WB Suggested Anti-DHPS Antibody; Titration: 1.0 ug/ml; Positive Control: MCF7 Whole Cell DHPS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DHPS antibody: synthetic peptide directed towards the N terminal of human DHPS. Synthetic peptide located within the following region: TTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 35 kDa
• Gene Name: deoxyhypusine synthase
• Database Link:
  NP_037538
  Entrez Gene 1725 Human
  UniProt ID P49366
• Background: This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
• Synonyms: DHS; DS; MIG13
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 93%; Rabbit: 93%; Rat: 86%; Guinea pig: 86%; Mouse: 79%