POLR2A Rabbit Polyclonal Antibody

CAT#: TA343189

Rabbit Polyclonal Anti-POLR2A Antibody

Product Images

Host: Rabbit; Target Name: POLR2A; Sample Tissue: Hela whole cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POLR2A antibody is: synthetic peptide directed towards the N-terminal region of Human POLR2A. Synthetic peptide located within the following region: DNKFGVEQPEGDEDLTKEKGHGGCGRYQPRIRRSGLELYAEWKHVNEDSQ
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 62 kDa
• Gene Name: polymerase (RNA) II subunit A
• Database Link:
  NP_000928
  Entrez Gene 5430 Human
  UniProt ID P24928
• Background: The function of this protein remains unknown.
• Synonyms: hRPB220; hsRPB1; POLR2; POLRA; RPB1; RPBh1; RpIILS; RPO2; RPOL2
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data

• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase