MIRO2 (RHOT2) Rabbit Polyclonal Antibody

CAT#: TA343207

Rabbit Polyclonal Anti-RHOT2 Antibody

Product Images

WB Suggested Anti-RHOT2 Antibody ; Positive Control: Lane 1: 20ug untransfected HEK293T Lane 2: 20ug RHOT2 transfected HEK293T; Primary Antibody Dilution : 1:1000; Secondary Antibody : Anti-rabbit-HRP; Secondry Antibody Dilution : 1:2000; Submitted by: Ji

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHOT2 antibody is: synthetic peptide directed towards the N-terminal region of Human RHOT2. Synthetic peptide located within the following region: TIPADVTPEKVPTHIVDYSEAEQTDEELREEIHKANVVCVVYDVSEEATI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: ras homolog family member T2
• Database Link:
  NP_620124
  Entrez Gene 89941 Human
  UniProt ID Q8IXI1
• Background: This gene encodes a member of the Rho family of GTPases. The encoded protein is localized to the outer mitochondrial membrane and plays a role in mitochondrial trafficking and fusion-fission dynamics.
• Synonyms: ARHT2; C16orf39; MIRO-2; MIRO2; RASL
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 91%; Dog: 86%; Rat: 86%; Mouse: 86%; Pig: 79%; Horse: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Transmembrane