PMP22 Rabbit Polyclonal Antibody

CAT#: TA343280

Rabbit Polyclonal Anti-PMP22 Antibody

Product Images

WB Suggested Anti-PMP22 Antibody; Titration: 1.0 ug/ml; Positive Control: 721_B Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PMP22 antibody is: synthetic peptide directed towards the N-terminal region of PMP22. Synthetic peptide located within the following region: QWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 18 kDa
• Gene Name: peripheral myelin protein 22
• Database Link:
  NP_696996
  Entrez Gene 5376 Human
  UniProt ID Q01453
• Background: This gene encodes an integral membrane protein that is a major component of myelin in the peripheral nervous system. Various mutations of this gene are causes of Charcot-Marie-Tooth disease Type IA, Dejerine-Sottas syndrome, and hereditary neuropathy with liability to pressure palsies. Alternative splicing of this gene results in three transcript variants that encode the same protein.
• Synonyms: CMT1A; CMT1E; DSS; GAS-3; GAS3; HMSNIA; HNPP; Sp110
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 86%; Sheep: 86%

Reference Data

• Protein Families: Transmembrane