CD200 Rabbit Polyclonal Antibody

CAT#: TA343315

Rabbit Polyclonal Anti-CD200 Antibody

Product Images

Host: Rabbit; Target Name: CD200; Sample Tissue: Fetal Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD200 antibody is: synthetic peptide directed towards the C-terminal region of Human CD200. Synthetic peptide located within the following region: GTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 21 kDa
• Gene Name: CD200 molecule
• Database Link:
  NP_005935
  Entrez Gene 4345 Human
  UniProt ID P41217
• Background: The function of this protein remains unknown.
• Synonyms: MOX1; MOX2; MRC; OX-2
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Mouse: 93%; Pig: 92%; Rat: 92%; Horse: 85%; Guinea pig

Reference Data

• Protein Families: Transmembrane