SAP102 (DLG3) Rabbit Polyclonal Antibody

CAT#: TA343321

Rabbit Polyclonal Anti-DLG3 Antibody

Product Images

Host: Rabbit; Target Name: Dlg3; Sample Tissue: Mouse Lung lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Dlg3 antibody is: synthetic peptide directed towards the middle region of Mouse Dlg3. Synthetic peptide located within the following region: FGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQFNDNL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 40 kDa
• Gene Name: discs large MAGUK scaffold protein 3
• Database Link:
  NP_066943
  Entrez Gene 53310 Mouse
  UniProt ID Q92796
• Background: Dlg3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling.
• Synonyms: MRX; MRX90; NEDLG; PPP1R82; SAP102; XLMR
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%