STRA8 Rabbit Polyclonal Antibody

CAT#: TA343351

Rabbit Polyclonal Anti-STRA8 Antibody

Product Images

Host: Rabbit; Target Name: Stra8; Sample Tissue: Mouse Liver lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Stra8 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Stra8. Synthetic peptide located within the following region: FLDKSEAQHMSNISAMFATCNSENPEEKFQLYIQIIEFFKSLGCVNTPLN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: stimulated by retinoic acid 8
• Database Link:
  NP_872295
  Entrez Gene 20899 Mouse
  UniProt ID Q7Z7C7
• Background: Stra8 is a meiosis-inducer required for the transition into meiosis for both female and male germ cells. In female germ cells, It is required for premeiotic DNA replication and subsequent events in meiotic prophase.
• Synonyms: stimulated by retinoic acid gene 8 homolog (mouse)
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Pig: 92%; Dog: 86%; Rat: 86%; Mouse: 86%