Myeloid zinc finger 1 (MZF1) Rabbit Polyclonal Antibody

CAT#: TA343390

Rabbit Polyclonal Anti-MZF1 Antibody

Product Images

WB Suggested Anti-MZF1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: MZF1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MZF1; Sample Tissue: Human Fetal Muscle; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: MZF1; Sample Tissue: Jurkat; Antibody Dilution: 1.0 ug/ml; MZF1 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MZF1 antibody: synthetic peptide directed towards the N terminal of human MZF1. Synthetic peptide located within the following region: RPAVLGSPDRAPPEDEGPVMVKLEDSEEEGEAALWDPGPEAARLRFRCFR
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 82 kDa
• Gene Name: myeloid zinc finger 1
• Database Link:
  NP_003413
  Entrez Gene 7593 Human
  UniProt ID P28698
• Background: MZF1 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 13 C2H2-type zinc fingers and 1 SCAN box domain. MZF1 may be one regulator of transcriptional events during hemopoietic development.
• Synonyms: MZF-1; MZF1B; ZFP98; ZNF42; ZSCAN6
• Note: Immunogen Sequence Homology: Dog: 100%; Human: 100%; Horse: 92%

Reference Data

• Protein Families: Transcription Factors