ZNF141 Rabbit Polyclonal Antibody

CAT#: TA343401

Rabbit Polyclonal Anti-ZNF141 Antibody

Product Images

WB Suggested Anti-ZNF141 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Placenta

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF141 antibody: synthetic peptide directed towards the middle region of human ZNF141. Synthetic peptide located within the following region: KCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: zinc finger protein 141
• Database Link:
  NP_003432
  Entrez Gene 7700 Human
  UniProt ID Q15928
• Background: Zinc finger encoding genes would be good candidates for being involved in the multiple developmental defects associated with chromosomal aneusomy--because of their role as transcriptional regulators, their abundance in the genome and their known association with specific developmental disorders. A zinc finger encoding cDNA (ZNF141) of the C2-H2/KRAB subfamily has been mapped to the 4p- (Wolf-Hirschhorn) syndrome (WHS) chromosome region. ZNF141 was expressed ubiquitously at low levels in the analysed tissue. The identification of a candidate gene for a chromosomal aneusomy syndrome belonging to a class of evolutionary conserved genes will provide options for studying its normal and abnormal expression during mammalian embryogenesis.
• Synonyms: D4S90; PAPA6; pHZ-44
• Note: Immunogen Sequence Homology: Human: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors