Calcipressin 1 (RCAN1) Rabbit Polyclonal Antibody

CAT#: TA343458

Rabbit Polyclonal Anti-RCAN1 Antibody

Product Images

RCAN1 antibody - middle region validated by WB using MOUSE OSTEOCLASTS at 1: 1000.

• 

  RCAN1 antibody - middle region validated by WB using Mouse Brain at 1: 500.

• 

  WB Suggested Anti-RCAN1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: Human Muscle

• 

  WB Suggested Anti-RCAN1 Antibody; Positive Control: Lane 1: 20ug Wild type mouse, left ventricle; Primary Antibody Dilution: 1: 1000; Secondary Antibody: Goat anti rabbit-HRP; Secondry Antibody Dilution: 1: 5, 000; Submitted by: Kathleen Gabrielson

• 

  Host: Rabbit; Target Name: RCAN1; Sample Tissue: Human Fetal Muscle; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane/lane; Gel Conc

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RCAN1 antibody: synthetic peptide directed towards the middle region of human RCAN1. Synthetic peptide located within the following region: PVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEME
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 28 kDa
• Gene Name: regulator of calcineurin 1
• Database Link:
  NP_004405
  Entrez Gene 54720 MouseEntrez Gene 1827 Human
  UniProt ID P53805
• Background: RCAN1 interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease.The protein encoded by this gene interacts with calcineurin A and inhibits calcineurin-dependent signaling pathways, possibly affecting central nervous system development. This gene is located in the minimal candidate region for the Down syndrome phenotype, and is overexpressed in the brain of Down syndrome fetuses. Chronic overexpression of this gene may lead to neurofibrillary tangles such as those associated with Alzheimer disease. Three transcript variants encoding three different isoforms have been found for this gene.
• Synonyms: ADAPT78; CSP1; DSC1; DSCR1; MCIP1; RCN1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transcription Factors