c Maf (MAF) Rabbit Polyclonal Antibody

CAT#: TA343530

Rabbit Polyclonal Anti-MAF Antibody

Product Images

WB Suggested Anti-MAF Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Hela cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAF antibody: synthetic peptide directed towards the N terminal of human MAF. Synthetic peptide located within the following region: MASELAMSNSDLPTSPLAMEYVNDFDLMKFEVKKEPVETDRIISQCGRLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: MAF bZIP transcription factor
• Database Link:
  NP_001026974
  Entrez Gene 4094 Human
  UniProt ID O75444
• Background: MAF acts as a transcriptional activator or repressor. It is involved in embryonic lens fiber cell development. It recruits the transcriptional coactivators CREBBP and/or EP300 to crystallin promoters leading to up-regulation of crystallin gene during lens fiber cell differentiation. MAF is also involved in the initial chondrocyte terminal differentiation and the disappearance of hypertrophic chondrocytes during endochondral bone development. When overexpressed, MAF represses anti-oxidant reponse element (ARE)-mediated transcription. It may be involved either as an oncogene or as a tumor suppressor, depending on the cell context.
• Synonyms: c-MAF; CCA4; CTRCT21
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 93%; Dog: 82%; Pig: 82%; Horse: 82%; Rabbit: 82%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors