c Maf (MAF) Rabbit Polyclonal Antibody

CAT#: TA343531

Rabbit Polyclonal Anti-MAF Antibody

Product Images

Host: Rabbit; Target Name: MAF; Sample Tissue: Lung Tumor lysates; Antibody Dilution: 1.0 ug/ml

• 

  Rabbit Anti-MAF Antibody; Paraffin Embedded Tissue: Human Lung cell; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MAF antibody is: synthetic peptide directed towards the C-terminal region of Human MAF. Synthetic peptide located within the following region: DAYKEKYEKLVSSGFRENGSSSDNPSSPEFFITEPTRKLEPSVGYATFWK
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: MAF bZIP transcription factor
• Database Link:
  NP_005351
  Entrez Gene 4094 Human
  UniProt ID O75444
• Background: The protein encoded by this gene is a DNA-binding, leucine zipper-containing transcription factor that acts as a homodimer or as a heterodimer. Depending on the binding site and binding partner, the encoded protein can be a transcriptional activator or repressor. This protein plays a role in the regulation of several cellular processes, including embryonic lens fiber cell development, increased T-cell susceptibility to apoptosis, and chondrocyte terminal differentiation. Defects in this gene are a cause of juvenile-onset pulverulent cataract as well as congenital cerulean cataract 4 (CCA4). Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: c-MAF; CCA4; CTRCT21
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors