c-Myb (MYB) Rabbit Polyclonal Antibody

CAT#: TA343535

Rabbit Polyclonal Anti-MYB Antibody

Product Images

Host: Rabbit; Target Name: MYB; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: AFTVPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSART
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 61 kDa
• Gene Name: MYB proto-oncogene, transcription factor
• Database Link:
  NP_001123644
  Entrez Gene 4602 Human
  UniProt ID P10242
• Background: This gene encodes a transcription factor that is a member of the MYB family of transcription factor genes. The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis. Alternative splicing results in multiple transcript variants.
• Synonyms: c-myb; c-myb_CDS; Cmyb; efg
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 86%; Rat: 86%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%; Horse: 79%; Bovine: 79%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors