NFIC Rabbit Polyclonal Antibody

CAT#: TA343543

Rabbit Polyclonal Anti-NFIC Antibody

Product Images

Host: Rabbit; Target Name: NFIC; Sample Tissue: Uterus Tumor lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-NFIC antibody is: synthetic peptide directed towards the N-terminal region of Human NFIC. Synthetic peptide located within the following region: MDEFHPFIEALLPHVRAFAYTWFNLQARKRKYFKKHEKRMSKDEERAVKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: nuclear factor I C
• Database Link:
  NP_995315
  Entrez Gene 18029 MouseEntrez Gene 4782 Human
  UniProt ID P08651
• Background: The protein encoded by this gene belongs to the CTF/NF-I family. These are dimeric DNA-binding proteins, and function as cellular transcription factors and as replication factors for adenovirus DNA replication. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• Synonyms: CTF; CTF5; NF-I; NFI
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Sheep: 93%; Bovine: 93%

Reference Data

• Protein Families: Transcription Factors