SOX3 Rabbit Polyclonal Antibody

CAT#: TA343547

Rabbit Polyclonal Anti-SOX3 Antibody

Product Images

WB Suggested Anti-SOX3 Antibody Titration: 1.25 ug/ml; ELISA Titer: 1: 1562500; Positive Control: MCF7 cell lysateSOX3 is supported by BioGPS gene expression data to be expressed in MCF7

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOX3 antibody: synthetic peptide directed towards the N terminal of human SOX3. Synthetic peptide located within the following region: MRPVRENSSGARSPRVPADLARSILISLPFPPDSLAHRPPSSAPTESQGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 45 kDa
• Gene Name: SRY-box 3
• Database Link:
  NP_005625
  Entrez Gene 6658 Human
  UniProt ID P41225
• Background: SOX3 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.
• Synonyms: GHDX; MRGH; PHP; PHPX; SOXB
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Mouse: 85%