PROP1 Rabbit Polyclonal Antibody

CAT#: TA343595

Rabbit Polyclonal Anti-PROP1 Antibody

Product Images

WB Suggested Anti-PROP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: COLO205 cell lysate; PROP1 is supported by BioGPS gene expression data to be expressed in COLO205

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PROP1 antibody: synthetic peptide directed towards the middle region of human PROP1. Synthetic peptide located within the following region: PSQPSTGGAFALSHQSEDWYPTLHPAPAGHLPCPPPPPMLPLSLEPSKSW
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25 kDa
• Gene Name: PROP paired-like homeobox 1
• Database Link:
  NP_006252
  Entrez Gene 5626 Human
  UniProt ID O75360
• Background: PROP1 has both DNA-binding and transcriptional activation ability. Its expression leads to ontogenesis of pituitary gonadotropes, as well as somatotropes, lactotropes, and caudomedial thyrotropes. Inactivating mutations in PROP1 result in deficiencies of
• Synonyms: CPHD2; PROP-1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rat: 90%; Sheep: 90%; Bovine: 90%; Mouse: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors