TRIM32 Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1
USD 867.00
Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 1
USD 396.00
Other products for "TRIM32"
Specifications
Product Data | |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TRIM32 antibody: synthetic peptide directed towards the N terminal of human TRIM32. Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 72 kDa |
Gene Name | tripartite motif containing 32 |
Database Link | |
Background | TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. |
Synonyms | BBS11; HT2A; LGMD2H; TATIP |
Note | Immunogen Sequence Homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.