RBM38 Rabbit Polyclonal Antibody

CAT#: TA343853

Rabbit Polyclonal Anti-RBM38 Antibody

Product Images

WB Suggested Anti-RBM38 Antibody Titration: 0.2-1 ug/ml; Positive Control: RPMI 8226 cell lysate; RBM38 is supported by BioGPS gene expression data to be expressed in RPMI 8226

• 

  Rabbit Anti-RBM38 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM38 antibody: synthetic peptide directed towards the N terminal of human RBM38. Synthetic peptide located within the following region: LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAER
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 26 kDa
• Gene Name: RNA binding motif protein 38
• Database Link:
  NP_059965
  Entrez Gene 55544 Human
  UniProt ID Q9H0Z9
• Background: RBM38 is a probable RNA-binding protein.
• Synonyms: dJ800J21.2; HSRNASEB; RNPC1; SEB4B; SEB4D
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Rat: 79%